SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003505 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003505
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.32e-86
Family ETFP subunits 0.00000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003505   Gene: ENSSSCG00000003229   Transcript: ENSSSCT00000003588
Sequence length 255
Comment pep:known chromosome:Sscrofa10.2:6:51672742:51688397:-1 gene:ENSSSCG00000003229 transcript:ENSSSCT00000003588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELRALVAVKRVIDFAVKIRVKPDRTGVVMDGVKHSMNPFCEIAVEEAVRLKEKKLVKE
VIAVSCGPAQCQETIRTALAMGADRGIHVEVPAAEAHHLGPLQVARVLAKLAQKEKVDLV
LLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAV
VTADLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKLSVVSVEDPPQRVAGVKVE
TTEDLVAKLREIGRI
Download sequence
Identical sequences Q6UAQ8
ENSSSCP00000003505 NP_001192208.1.46622 ENSSSCP00000028993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]