SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003582 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003582
Domain Number 1 Region: 89-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-62
Family SPRY domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000972
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003582   Gene: ENSSSCG00000003303   Transcript: ENSSSCT00000003667
Sequence length 288
Comment pep:known chromosome:Sscrofa10.2:6:54946466:54951574:1 gene:ENSSSCG00000003303 transcript:ENSSSCT00000003667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHIKETSKCSICLTYLENPMYLKCGYICCFKCLNSLKKEPDGEGLLCPNCSVVSQKKD
LIGARKLGELVSKVKDLEPHLTEVLRMNPRIRKLQVDVTLDADTANKQLIISEDLKTVHC
GLLKQKKEACPERFSDTLCVLGLPRFTSGRHYWEVDVESSREWDVGVCKESVHRQGMIQL
SPDRGFWTVSLRRGQFYSAGTVPSTVLRVNPRLHRVGIFLDLNSRSISFYHISDGSHIFT
FTKLPTAEPLRPFFSPGSATRDAQCFLRICPVVNLGIDSPPANPGSSK
Download sequence
Identical sequences A0A287BM96
XP_003127523.1.46622 ENSSSCP00000003582 ENSSSCP00000003582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]