SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003630 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003630
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.78e-37
Family Ribosomal protein L20 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003630   Gene: ENSSSCG00000003347   Transcript: ENSSSCT00000003716
Sequence length 149
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:58274549:58279707:-1 gene:ENSSSCG00000003347 transcript:ENSSSCT00000003716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLK
KRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPDGIFSRVVQHR
Download sequence
Identical sequences A0A286ZU56
ENSSSCP00000003630 4v19_U 5aj4_BU 6gaw_BU 6gb2_BU XP_003127555.3.46622 ENSSSCP00000003630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]