SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003671 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003671
Domain Number 1 Region: 27-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000424
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003671
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00232
Family TNF receptor-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003671   Gene: ENSSSCG00000003386   Transcript: ENSSSCT00000003757
Sequence length 255
Comment pep:known chromosome:Sscrofa10.2:6:63053856:63071356:1 gene:ENSSSCG00000003386 transcript:ENSSSCT00000003757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGYYNIVATVLLVMNFERTRSVPDPCSNCSAGTFCGKNIQELCMPCPSNSFSSTSGQK
ACNVCRKCEGVFRTKKECSSTSNAVCECVPGFRCLGAGCAMCEEYCQQGQELTQEGCKDC
SFGTFNDEEHGVCRPWTDCSLAGKPVLMNGTKARDVVCGPRPTDFSPGTPSTTMPVPGGE
PGHTSHVIIFFLALMSTAVFVLVSYLALRFSVVQQGRKKLLYIVKQPFLKPAQTVQEEDA
CSCRFPEEEEGECEL
Download sequence
Identical sequences A0A288CFZ9
NP_001254002.1.46622 ENSSSCP00000003671 ENSSSCP00000003671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]