SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003676 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003676
Domain Number 1 Region: 22-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.45e-83
Family Carbonic anhydrase 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003676   Gene: ENSSSCG00000003391   Transcript: ENSSSCT00000003762
Sequence length 317
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:63673118:63695144:-1 gene:ENSSSCG00000003391 transcript:ENSSSCT00000003762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALVTLLFLLLLGAQTQHGAEWTYSDGELDEAHWSREYPDCDGRRQSPIDVQRKSVQYN
PALRALSLTGYEAQEGEFSMINNGHTVQISLPSTMRLTAPDGTQYIAKQMHFHWGGAFSE
ISGSEHTIDGIRYVTEVHVVHYNSKYKSYDEAQTAPDGLAVLAALFEIKDYAENTYYSDF
ISHLKNIRNPGQTTVLSSLNLQDMLPENLHSYYSYQGSLTTPPCTENVHWFVLADTVKLS
RTQVWKLQNSLLNDQNKTIHNDYRRTQPLNHRVVEANFKSLPNPRSELHFYLNNIDNNLE
YLRRVIEQKKAKGKGPW
Download sequence
Identical sequences F1RIH8
ENSSSCP00000003676 ENSSSCP00000003676 9823.ENSSSCP00000003676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]