SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003680 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003680
Domain Number 1 Region: 313-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-27
Family Clostridium neurotoxins, the second last domain 0.045
Further Details:      
 
Domain Number 2 Region: 122-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000113
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 57-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003680   Gene: ENSSSCG00000003396   Transcript: ENSSSCT00000003767
Sequence length 931
Comment pep:known chromosome:Sscrofa10.2:6:63989937:64029778:1 gene:ENSSSCG00000003396 transcript:ENSSSCT00000003767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWLEPTYHGLVTESDSAVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIH
GQNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANVKKSHKATV
HIQVNDVNEYAPVFKEKSYKATVVEGKQYDSILRVEAVDADCSPQFSQICSYDIVTPDVP
FTIDKDGYIKNTEKLTYGKERQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNN
RVEYEPGTGALALFPNVHLETCDASVASVQVAVELETSHIGKGCDRDTYSEKSLHRLCGA
SSGTAELLPSPSGSLNWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVDPKEPFTISV
WMRHGPFGRKKETVLCSSDKTDMNRHHYSLYIHGCRLIFLLRQDPSEEKKYKPAEFHWKL
HQVCDEEWHHYVLNVDIPSVVLYVDGASHEPFSVTEDYPLHPSSIETQLVVGACWQGGDL
HMTQFFRGNLAGLTIRSGKLADKKVIDCLYTCKEGLELHLPEDSGRGVKIHATPSQSVLT
LEGEDVGDLDKAMQHIAYLNSRQFPTPGIRRLKITTTVTCFSEATCISIPPLDGYVMVLQ
PEEPKISLSGIHHFARAASEFESSEGVFLFPELRIISTITREVEPEGEGDEDPTVQESLV
SEEIVHDLDTCEVTVEGEELNREQETLEVDTARLQQKGIEVSSSDLGMVFTGVDTMASYE
EVLHLLRYRNWHTRSLLDRKFKLVCSELNGRYVSNEFQVEVNVIHTANPVDHASHMAAQP
QFVHPEHRSFIDLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRT
MRDQDSGKENEMDWDDSALTITVNPMETYEDQHSSEEEEEEEEEESEDGDEEDDITSAES
ESSEEEEGEHGDQQTASRQQQLEWDDSTLSY
Download sequence
Identical sequences ENSSSCP00000003680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]