SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003754 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003754
Domain Number 1 Region: 8-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.05e-86
Family Eukaryotic proteases 0.0000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003754   Gene: ENSSSCG00000027215   Transcript: ENSSSCT00000003842
Sequence length 268
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:69055983:69062605:1 gene:ENSSSCG00000027215 transcript:ENSSSCT00000003842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGITVLAALLAYASSCGVPSFPPNLSARVVGGENAIPHSWPWQISLQYLSGDTWKHTCG
GTLITSTHVLTAAHCISNSRTYRVALGKNNLEVEDEEGSLVVGVDSIFVHEKWNSLLIRN
DIALIKLAEPVELSDTIQVSCLPEEGSLLPQDYPCYVTGWGRLWTNGPIAAELQQGLQPV
VDHATCSQRDWWGSTVRDTMVCAGGDGVISACNGDSGGPLNCQAENGSWEVRGIVSFGSG
LGCNTYKKPTVFTRVSAYIDWIDQKIQL
Download sequence
Identical sequences F1SUW2
ENSSSCP00000003754 ENSSSCP00000003754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]