SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003756 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003756
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-86
Family Eukaryotic proteases 0.00000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003756   Gene: ENSSSCG00000003459   Transcript: ENSSSCT00000003844
Sequence length 269
Comment pep:known chromosome:Sscrofa10.2:6:69072038:69088197:1 gene:ENSSSCG00000003459 transcript:ENSSSCT00000003844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Download sequence
Identical sequences P08419
NP_999274.1.46622 ENSSSCP00000003756 9823.ENSSSCP00000003756 ENSSSCP00000003756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]