SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003788 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003788
Domain Number 1 Region: 31-262
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000144
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003788   Gene: ENSSSCG00000003489   Transcript: ENSSSCT00000003876
Sequence length 893
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:71787700:71809159:-1 gene:ENSSSCG00000003489 transcript:ENSSSCT00000003876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAAASRFWLWAALLIPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVA
TEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLYGQDAITVSNGGRIMRSWETNIGGL
NWEMTLDSGSFQALGLVGLQESVRYVAVLKKTTLALHHLSSGHLKWAEHLPESDNIHYQM
VYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVVDEAVLVC
PDPSSRSLQTLALETEWELRQIPLQSLDLEFASGFQPRVLPTQPNPMDPSRAQFFLQLSP
SHYALLHHHHGVLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEVQKPSSSEDGSMGSFS
EKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERLYIQVFLKKDDSV
GYRALVQTEDHLLLFLQQLAGRVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKA
DGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMV
MVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETG
MSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDYAKVLLLIDDEYKVTAFPATRN
VLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTPPEVQRIVTVKGKRSSEH
VHSQGRVMGDRSVLYKSLNPNLLAVVTESTDVHHERTFIGIFLVDGVTGRIIHSSVQRKA
RGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSY
IFPSPISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSR
Download sequence
Identical sequences ENSSSCP00000003788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]