SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003816 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003816
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-18
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0043
Further Details:      
 
Domain Number 2 Region: 162-232
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000209
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003816   Gene: ENSSSCG00000003516   Transcript: ENSSSCT00000003906
Sequence length 375
Comment pep:known chromosome:Sscrofa10.2:6:73868350:73879329:-1 gene:ENSSSCG00000003516 transcript:ENSSSCT00000003906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLSPPLGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKL
QLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTQEKPNTTIQVPAFLQELVDR
DNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDEST
PTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERC
RVLRLKNQLNEDYKTVNNLLKATVKGSDGFWVGKSSLRSWRQLALEQLDEQDAEADQSNG
KMNGNTLNKDESKEERKEEEEELNFNEDILCPHGKPKCKTSVSLTSACHIFFVFWPFLGP
LPTAYGGSQVRGQIG
Download sequence
Identical sequences ENSSSCP00000003816 ENSSSCP00000003816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]