SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003824 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003824
Domain Number 1 Region: 628-912
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-81
Family Protein kinases, catalytic subunit 0.00000000316
Further Details:      
 
Domain Number 2 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-70
Family Ephrin receptor ligand binding domain 0.00000177
Further Details:      
 
Domain Number 3 Region: 328-535
Classification Level Classification E-value
Superfamily Fibronectin type III 7.47e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 934-1001
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003824
Domain Number - Region: 259-325,360-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000746
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003824   Gene: ENSSSCG00000003523   Transcript: ENSSSCT00000003914
Sequence length 1005
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:74544993:74579158:1 gene:ENSSSCG00000003523 transcript:ENSSSCT00000003914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFRPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGSSTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPTMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACRCDLSYYRAALDPPSAACTRPPSAPVNLISSVNGTSVTLEWAPPLDRGGRSDI
TYNAVCRRCPWALGHCETCGSSTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKRRHCGYSKAFQHSDEEKMHYQNGQAPPPVFLPLHRP
PGKIPEPQFYAEPHTYEEPGRAGRGSTREIEASRIHIEKIIGSGESGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDGNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVNRCPPPAFARSCFDLRGGGGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences ENSSSCP00000003824 ENSSSCP00000003824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]