SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003828 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003828
Domain Number 1 Region: 598-899
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 1-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-77
Family Ephrin receptor ligand binding domain 0.0000000164
Further Details:      
 
Domain Number 3 Region: 306-513
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-41
Family Fibronectin type III 0.0000311
Further Details:      
 
Domain Number 4 Region: 895-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.32e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 235-306,344-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000184
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003828   Gene: ENSSSCG00000003527   Transcript: ENSSSCT00000003918
Sequence length 971
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:74751030:74880164:1 gene:ENSSSCG00000003527 transcript:ENSSSCT00000003918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDSTTATAELGWIVHPPSGPQWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFI
RRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKV
DTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCP
RIIQNGAVFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKA
GFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLD
MPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDN
VQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSA
VSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKGSQGPVSTRFAIKSPTNTVTVQ
GLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLI
AVVVIAIVCNRRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKE
IDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMG
QFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMK
YLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAP
EAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSAL
HQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSF
NTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMR
AQMNQIQSVEV
Download sequence
Identical sequences ENSSSCP00000003828 ENSSSCP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]