SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003903 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003903
Domain Number 1 Region: 56-293
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.98e-62
Family Alanine racemase-like, N-terminal domain 0.00000028
Further Details:      
 
Domain Number 2 Region: 258-411
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.42e-33
Family Eukaryotic ODC-like 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003903   Gene: ENSSSCG00000003599   Transcript: ENSSSCT00000003994
Sequence length 424
Comment pep:novel chromosome:Sscrofa10.2:6:81759792:81770496:1 gene:ENSSSCG00000003599 transcript:ENSSSCT00000003994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPVGTSKESGESPGSMWPKDLILLEPGETAWQVVLKKIRELSDGDVQDPFMVANLDVL
PRRHQLFHQALPRVSPFYAVKCNNNPWVLRVLAALGTGFDCASQGELEQVLGLGVPPSRI
IYANPCKPVSHILYAAHHGVQLLTFDSEEELIKVAQHYPGARLVLRLWTQDSESIFSLST
KFGARLELCEHLLKSARDLGVAVVGTRIGTADSERTTTVQQAIADCRCLFEMGLRIGHDM
NFLDIGGGFPGEEGLDPKFEEMAGVINATLAQDFPEGSGVEIIAEPGRFYAAPVCTIAVN
IIAKKAVVQPGGHRKLLYYLNDGYYGDFRVFLRDPEPKIPIVVKELGPEPPLFSCILFGP
TCDAFDKLFLEELQLPELNVGDWLVFPTMGAYTNVMTSTFNGFPPASICCTVGPELSTLL
PTLA
Download sequence
Identical sequences ENSSSCP00000003903 ENSSSCP00000003903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]