SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003904 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003904
Domain Number 1 Region: 140-453
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-73
Family Papain-like 0.00000927
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003904
Domain Number - Region: 117-141
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00107
Family PMP inhibitors 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003904   Gene: ENSSSCG00000003600   Transcript: ENSSSCT00000003995
Sequence length 467
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:81806755:81821191:1 gene:ENSSSCG00000003600 transcript:ENSSSCT00000003995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRCPLGLLLLLLLAGELALGARRGRGRRELAPALHLRGIRDAGGRYCQEQDLCCHGRAD
DCALPYLGATCYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHRGRIYPVLGTYWD
NCNRCTCQEKGQWECDQEPCLVDPDMIKAINQGNYGWRAGNHSAFWGMTLDEGIRYRLGT
IRPSSSVANMNEIHTVLGPGEVLPRAFEASEKWPNLIHDPLDQGNCAGSWAFSTAAVASD
RVSIHSLGHMTPVLSPQNLLSCDTHNQQGCQGGRLDGAWWFLRRRGVVSDHCYPFSGHER
NEAGPAPRCMMHSRAMGRGKRQATARCPNSYVHANDIYQVTPAYRLGSNEKDIMKELMEN
GPVQALMEVHEDFFLYQSGIYSHTPVSHGRPERYRRHGTHSVKITGWGEETLPDGRMLKY
WTAANSWGPGWGERGHFRIVRGANECDIESFVLGVWGRVGMEDMGHP
Download sequence
Identical sequences ENSSSCP00000003904 9823.ENSSSCP00000003904 ENSSSCP00000003904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]