SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003907 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003907
Domain Number 1 Region: 67-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-23
Family Laminin G-like module 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003907   Gene: ENSSSCG00000003603   Transcript: ENSSSCT00000003998
Sequence length 1594
Comment pep:known chromosome:Sscrofa10.2:6:82011453:82064725:1 gene:ENSSSCG00000003603 transcript:ENSSSCT00000003998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWASWAPGLWLLSICITCSHGAGTGEQCPPSQQEGLKLEHRSDLSTNVTGFNLIHRLSLM
KTSAIKKIRNPKGPLILRLGATSVTQPTRRVFPRGLPGEFALVLTLLLKKHTHQKHVVFV
QVTDGDGTRSISLEVNSQERSLELRARGQDGDFVSCIFLVPQLFDLRWHKLVLSVAERVA
SVHVDCTSASSQPLGPRRPIRPVGHVFLGLDAEQGKPVSFDLQQAHIYCDPEFVLEEGCC
EISPGGCPPETSKARRDTQSNELIEINPQTEGKVYTRCFCLEEPQNSKVDAQLTGGISQK
AERGAKAHQDTAADECPPCVHGARESNVTIGPSGPKGGKGEPGPPGPLGPKGEKGARGND
CVRISLDAPLRCSEGPKGEKGESGALGPSGLPGSTGQKGQKGEKGDGGIQGSPGKPGRDG
RPGEICVMGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKG
SSGVPGKEGPGGKPGKPGVPGLKGQKGDPCEVCPTLPKGFENFVGLPGKPGPKGEPGDPA
PAREGLRAVGQKGDRGDPGIQGLKGEKGEPCSSCSSAVAAQHLGPSTGAKGDVGPPGLGV
PGLPGKVGAPGPTGLKGEKGNFGEAGPAGSPGPPGPVGPTGIKGEKGEPCEPCPALFQHQ
EEDSHVVALPGPPGKKGEPGPPGFGLPGKHGKAGERGLKGQKGDAGNPGDGIPGTTGQPG
LSGEPGVRGPAGPKGEKGDGCTACPSLQGAMTNMAGQPGKPGPKGDQGPEGVGRPGKPGQ
PGLPGVQGPPGLKGIQGEPGPPGVGVQGSQGEPGAQGLPGTQGPPGPQGPPGPAGGKGAK
GSPGVKGATGPVGPPGASVSGPPGEKGSQGEKGEPGECSCPSRGDPIFSGMPGAPGLWMG
SSWQPGPQGPPGVPGPPGPPGMPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGD
CLGQTAHPAALLENGEKGAQGIPGVPGLDSCARCFMEREHPRAEEARGDNGEGDPGCAGS
PGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGLQGERGLRGLTGEKGEPGPPGQPGYPGA
MGPPGLPGIKGERGYAGSPGEKGESGPPGSEGLPGPPGPAGPRGERGPQGNSGEKGDQGF
QGQPGFPGPPGPPGFPGKAGAPGPPGPQAEKGSEGIRGPSGLPGPPGPPGSPGIQGPAGL
DGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKPGHPGLPGPKGDCGKPGPPGSSEWGRP
SRLLQGEPGAMGPQGRPGPPGHIGPPGPPGQPGPAGISAVGLKGDRGSPGERGLLGLPGQ
PGPPGHPGPPGEPGMDGAAGKEGPPGKQGLYGPPGPKGDPGPSGQKGQAGEKGRAGMPGG
PGKSGSMGPVGPPGPAGERGHPGSPGPAGSPGLPGVPGSMGDMVNYDEIKRFIRQEIIKM
FDERMAYYTSRMQFPMEMVAAPGRPGPPGKDGAPGRPGSPGSPGLPGQIGREGRQGLPGV
RGLPGTKGEKGDIGVGIAGEIGLPGPPGPQGPPGYGKMGATGPMGQQGIPGIPGPPGPMG
QPGKAGHCNPSDCFGAMPMEQQYPPMKNMKGPFG
Download sequence
Identical sequences ENSSSCP00000003907 ENSSSCP00000003907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]