SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003908 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003908
Domain Number 1 Region: 84-139
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000523
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 33-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000109
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 198-245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 4 Region: 139-194
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 648-839,876-945
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000174
Family Rhodopsin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003908   Gene: ENSSSCG00000003604   Transcript: ENSSSCT00000003999
Sequence length 1310
Comment pep:known chromosome:Sscrofa10.2:6:81956138:81986369:1 gene:ENSSSCG00000003604 transcript:ENSSSCT00000003999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYGEEPEEEPKKTQWPRSADELGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCV
SSPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHG
GKACEGPELQTKLCSMAACPVEGQWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCT
GALTDTRECGNLECPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQATGAQGYPCEGTGE
EVKPCSEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVA
YWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLL
FSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDAENKDKWDDAQQVSPGSVHLLRV
VEDFIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSED
RLFLPKEVLSLSSPGKPAASASGAAGSLGRGRGPGTVPPGPGHSHQRLLPADPEEASSYF
VIGAVLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHC
ASWDYSRADASSGDWDTESCQTLETQAAHTRCQCQHLSTFAVLAQPPKDLTLELAGSPSV
PLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASNILILVGQSRVLSKG
VCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSV
GFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKK
QRAGSERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVLA
MTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSCKN
GQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLS
FSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPAEPGSEGDYMVL
PRRTLSLQPGAGGGGEDPPRARPEGTPRRAAKALTHTEGYPSFLSVDHSGLGLGPAYGSL
QNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLERKKLRYSDLDFEKVM
HTRKRHSELYHELNQKFHTFDRYRSQSTAKREKRWSVSSGGAADRSVASEKPSPGERPGL
SQQRRHQSWSTFKSMTLGSLPPKPRERLALHRAAAWEPTEPPDGDFQTEV
Download sequence
Identical sequences ENSSSCP00000003908 ENSSSCP00000003908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]