SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003939 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003939
Domain Number 1 Region: 25-365
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.27e-69
Family ADP-ribosylglycohydrolase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003939   Gene: ENSSSCG00000003634   Transcript: ENSSSCT00000004030
Sequence length 369
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:85528199:85534297:1 gene:ENSSSCG00000003634 transcript:ENSSSCT00000004030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARMAVAAMTAAAAASGGAGAARSLSRFRGCLAGALLGDCVGAVYEARDTVDLTSVLRQV
QDLEPDPGSAGSPRTEALCYTDDTAMAKALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRG
YGAGVITVFRKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYNSVQDVQKFAR
LSAQLTHASSLGYNGAILQALAVHLALQGESSSEHFLEQLLGHMEELESDAQSKSDAREL
GMEECPYSSRLKKIGELLEQDSVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIP
SAFNNLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMEQVPESWQQSCEGYEETDVLAQS
LHRVFQKSL
Download sequence
Identical sequences ENSSSCP00000003939 ENSSSCP00000003939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]