SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004128 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004128
Domain Number 1 Region: 20-137,190-417
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.76e-109
Family Autophagin-like 0.00000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004128   Gene: ENSSSCG00000003816   Transcript: ENSSSCT00000004223
Sequence length 458
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:137803101:137886719:-1 gene:ENSSSCG00000003816 transcript:ENSSSCT00000004223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGTDEVDKLKTKFVSAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKLLP
ARSGCTIKDHVIAGNVEEFRKDFISRIWLTYREEFPQLEGSALTTDCGWGCTLRTGQMLL
AQGLVLHFLGRAWTWPDALNIENSDSESWTSNTVKKFTASFEASLSGERELKTPTISLKE
TIGRYSDDREKQNEIYHRKIISWFGDSPLTLFGLHQLIECGKKSGKKAGDWYGPAVVAHI
LRKAVEEARHPDLQGITIYVAQDCTVYSSDVIDKQCASMAPDNTDDKAVIILVPVRLGGE
RTNADYLDFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDF
PLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKSSSKEKYPLFTFVN
AHSRDYDFTSTTTNKEDLFSEDEKKRLNRFSTEEFVLL
Download sequence
Identical sequences F1S810
XP_013844341.1.46622 9823.ENSSSCP00000004128 ENSSSCP00000004128 ENSSSCP00000004128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]