SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004132 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004132
Domain Number 1 Region: 81-220,426-463,490-602,743-785
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004132   Gene: ENSSSCG00000003820   Transcript: ENSSSCT00000004227
Sequence length 786
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895204.1:2386:12907:1 gene:ENSSSCG00000003820 transcript:ENSSSCT00000004227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVIPXPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKTSEYRGSEVD
QVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISR
KKEALKDEANQKEKGNGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELAT
QPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVTELSKVEEKH
QKEEMSGNDSMEMDNMKHSEDYKEKLPKGNGKRKSDTEFGNMKKKVKVCKEHQSLEENQR
QTRSKRKATGDTLEIPPKINPKYISENESGRPSQKKSRVKINWLKSSAKQPSILSKFCSL
GKITTNQGSKGQSKENEYDVEEDLGKCENDNTTNGCGLESPGNNVMPINVNEVKPINKGA
EQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEP
KTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAAS
GLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASV
KVTDLNSLELDKENFVIDQMCEVGKPEPLNEEEARGVVENYDDEEVSIRVSGSTQPSKVL
NKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTALAENRNSETNTNGTHESDRNKESS
DQIGINISGFENKISYIVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYL
LFYKKL
Download sequence
Identical sequences ENSSSCP00000004132 ENSSSCP00000004132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]