SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004150 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004150
Domain Number 1 Region: 135-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000772
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004150
Domain Number - Region: 511-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000723
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 555-569
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0379
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004150   Gene: ENSSSCG00000003834   Transcript: ENSSSCT00000004245
Sequence length 610
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:143164815:143205954:1 gene:ENSSSCG00000003834 transcript:ENSSSCT00000004245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSQISCRIEKMKTSGTWAWRMPAKLFLLCAALGCLSLPGSRGERPHSLESNAVNESLG
KSRQTRSVDVTLTPIDCELSSWSSWTTCDPCQKKRYRHASLLRPSQFHGEPCNFSDKEVE
DCVSNRPCRSQVRCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCKRIYKKCQQEMDQ
YWAIGSLASGINLFTNNLEGPVLDHRYYAGACSPHYILNTRFRKPYNVENFNPQTQGKYD
FALTEYESYSDFEQNVTTAAISKSSFSFGFKISGMFEFGISSTSDKGKRFISRTKRFSHT
KSTFLHARSDLEVARYKLKSRNLMLHYEFLQRVKQLPLEYSYGEYRDLFRDFGTHYITEA
VLGGVYEYTLIMNKEAMERADYSLKDVHACAQHGFKIGVAIEEVYIKLGVSVHKCKDILN
EIKDRNKRSSMVNDLVVLVRGGASEHITALAYKDLPTADLMQEWGDAVQYNPDIIKIKAE
PLYELVTAADFAYSSTVKQNMKRALEEFEKEISSCHCAPCQGNGVPVLKESRCDCICPAG
FQGSACEVTNRKNVPIDGKWNCWSDWSPCLEDVKQDEGSATIHLLKMGAAPAWVLLQKHL
TVKEGRASSG
Download sequence
Identical sequences ENSSSCP00000004150 ENSSSCP00000004150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]