SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004152 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004152
Domain Number 1 Region: 519-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000068
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 46-120,171-184,472-510
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 15-63
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004152   Gene: ENSSSCG00000003835   Transcript: ENSSSCT00000004247
Sequence length 564
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:143217660:143266610:-1 gene:ENSSSCG00000003835 transcript:ENSSSCT00000004247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRVSRAVLSSTPTAVSCQLSNWAEWTECFPCQDKKYRYRSLLQPNKFGGAICSGNVWDQA
SCHSPTECLRQAQCGQDFQCKETGRCLKRHLVCNGDRDCLDGSDEDDCEDVRIFEDDCSQ
YDPIPGSERATLGYNILTQEETQSVYDARYYGGQCETVYNGEWRELRYDSACERLYYGDD
EKYFRKPYNFLKYHFEALADSKFSSESYDDANDLLKKVKNEKSVSAGVTVGIGPTGSPFT
ANVGLSGSRESAFLNKLSKYNEKKYSFIRIFTKVQTASFKMRRDNIMLDEVMLQSLMELP
EQYNYGMYAKFIDDYGTHYITSGSMGGVYEYILVLNKENMTKSGVTSDDVTSCFGGSFGI
DYDYTDNLQITGSLSGKHCKKLGGGHREDEESNMAVEDIISRVRGGSSGWGGGLTQNGSI
ITYRAWGRSLKYNPAVIDFEMKPIYEILRHTNLGPLEAKCQNLRRALDQYLMEFNACRCG
PCFNNGEPILVGTSCRCQCPVGYQGLACEQMKSEGAKADGRWSCWSSWSACRLGTQERRR
ECNNPAPQNGGASCSGHIVQTQAC
Download sequence
Identical sequences ENSSSCP00000004152 ENSSSCP00000004152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]