SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004184 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004184
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-55
Family Calnexin/calreticulin 0.0003
Further Details:      
 
Domain Number 2 Region: 170-285
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.23e-37
Family P-domain of calnexin/calreticulin 0.00000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004184   Gene: ENSSSCG00000003871   Transcript: ENSSSCT00000004283
Sequence length 386
Comment pep:novel chromosome:Sscrofa10.2:6:148304048:148324553:1 gene:ENSSSCG00000003871 transcript:ENSSSCT00000004283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNPIDGWKKQWVESKHRPDYGKFQLVQEDFYGDEEKDKGLQTSEDAKFYALSTFSNENET
LVVQFSVKYEQGIDCGGRYVKLFPDTLNQEDMHSEYYIMFGLDICGFGNNKVGVILCYQG
KYHENNKTIKCRDHKDTHLYTLIIHPNATYEVKIDNQQVAAGDLEDDWAFLPPRKIKDPY
AQKPRKWERLQVEDPEDKKPEIWEMTGKTEFIPDPNAKKPEDWNEAMDGEWEGPLIPNLK
YKGQWKPQIIDNPNYQGEWIHPEIDNPKYKPDPTICHYYNISVLGLDLWQVKSGSIFDNF
LLTNDEKFAEVVGNKTQGIRKERRKRSNRRELHEEMEKRKQHEEAKKMNEKEKEREGDIG
GTEEEGSEEDSAEESGTNRQLKEDDA
Download sequence
Identical sequences ENSSSCP00000004184 ENSSSCP00000004184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]