SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004368 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004368
Domain Number 1 Region: 316-463
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 2 Region: 171-309
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-29
Family Mannose 6-phosphate receptor domain 0.0022
Further Details:      
 
Domain Number 3 Region: 9-79,129-177
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-19
Family Mannose 6-phosphate receptor domain 0.004
Further Details:      
 
Domain Number 4 Region: 79-128
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-16
Family Fibronectin type II module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004368   Gene: ENSSSCG00000004042   Transcript: ENSSSCT00000004470
Sequence length 671
Comment pep:known chromosome:Sscrofa10.2:1:9023234:9039694:1 gene:ENSSSCG00000004042 transcript:ENSSSCT00000004470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAAVVPSLQVTRDSRTYSVGVCTAAAGLDQGGCKDGGVCLLSGSRGASFGRLASMKLDY
RHQDEAVILSYANGDNCPPETEEGDPCVFPFTLNGKSYEECVLEGRARLWCATTADYDRD
HEWGFCRHSNSHRTSAIIFKCDEDADVGRPQVFSEVRGCEVTFEWKTKVVCPPKKMECKF
VQKHRTYDLRLLSSLTGSWFFVHDGASYYLNLCQRIYKGPLDCSDRASVCKKNPSGNVQV
LGLVHTQKLDVIGDRVVVTYSKGHQCGGNKTASTVIELTCAKTVGRPSFSRFDVDSCTYH
VRWDSRAACAVKPQEVHMVNGTFTNPASGQSFSLGDIYFKRFSASGDMRANGDKYLYEIQ
LSSITSATHPACAGANICQVKPNDQHFSRKVGTSDKTKYYIQDGDLDVVFASSSKCGKDK
TKSVSSTIFFHCDPLVKDGSPEFSHETADCQYLFSWYTSAVCPLEAGFGKNTGDDEPEHK
GLSERSQAVGAILSLLLVALTGCLLTLLLYKKERREAVMSRLTSCCRRGASVSYKYSKVN
KEEEADENETEWLMEEIQLPTPRPGKEAQENGHITTKSVKAEALSSLRGDDQDSEDEVLT
IPEVKVHPGRGPGDEGAHPMRPPQRQVLRERADDRVGLVLEEPARRGRPRAAHNKAVNSF
HDDSDEDLLHI
Download sequence
Identical sequences ENSSSCP00000004368 ENSSSCP00000004368 9823.ENSSSCP00000004368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]