SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004450 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004450
Domain Number 1 Region: 28-348,610-628
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.41e-36
Family Calpain large subunit, catalytic domain (domain II) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004450
Domain Number - Region: 761-845
Classification Level Classification E-value
Superfamily Globin-like 0.000374
Family Globins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004450   Gene: ENSSSCG00000004114   Transcript: ENSSSCT00000004553
Sequence length 1641
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:21065219:21249084:-1 gene:ENSSSCG00000004114 transcript:ENSSSCT00000004553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPFSSNLQPSEQKKGRFPIWPEWSEADINAEKWDAGKGGKEKDKTGKSPVLHCFEDPEGK
IEFPPSLKIYSWKRPQDFLINRPPVVVKNETLFDLFSANEHLLCSELMRWIISEIYAVWK
IFNGSALTNYLKGTSGEPPVLAWKPWEHIYSLCKAVKGHTPLFNSYGKYVVKLYWMGCWR
KITIDDFLPFDEENNLLLPATTYEFELWPMLLSKAIIKLANVDIHVAERRELGEFTVIHA
LTGWLPEVISLHPRYMDKVWELLKEILPEFKLSNESNSESKIAEIDAKLKEQGKDMKDVK
NGKEVKDGKEFKPEGSATTLKFPEKSDKVLKEKADAKDLGKKKSKDGEKEREKDKFKWSL
HGSRPSSDVQYSLQSLSECSSAIQSPQMVVYATFTPLYLFEKKIFLLEKMASSAEKLREY
GLSHICSHPVLVTRTRSCPLIAPPKPPPVPSWKLFRQKKETVITDEAQEVVIKKPEQFLE
ISSPFLNYRMPPFTIPTETHFVQSFIKKGVLPGSGLSSITENDETAVYSQIDLGQLTRNI
SQGNIASQAVLGKALLLLCTDELMDFGLNDIAHPAEGVSLERDLFSQTTATQEKSQEELA
TIDNGVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKTEFKFSDERVSYYLFVDSLKP
IELLVCFSALVRWGESGALTKNSPPTEPGLLIAETVSWKSVSPRDPVAKIHTYATKATVV
RLPIGRHMLLFTAYAPVGHSIHICSMVTFVVGDEDVVLPNFEPESYRFTEQSLTILKAVG
HVIANFKYKGKLPAALKHLQAAHYPIPLQDKELTAQHFRVFHNSLWRLMKKVQIAKPPPN
LKFAFRALVLDLDSLDSSLEEASLAEWVDVKNNVPASDKEYSPEEIAAAIKIQAMWRGTY
VRLLMKARTPDTQENTSVAETLQKLWAVLEQNIEQYAISLLRLMFKSKCKSMESYPCYQD
EETKVAFADYIVTYSDQPPNTWFIVFRETFLVPQDMILVPKIYTTLPVCMLHVVNNDTME
RVPKLFQKVVPYLYTKNKKGYTFVAEAYTSDLYVSSARWKLRLIGSYHPLPCLSRDPPCN
TFAIKEIRDYYIPNDKKLVFRYSIKVALPHPVTIQVRVSKPDAFIKLQILENEEVIVSST
GKGQAIIPTVNFLGNEKALSSQSSKQILSHASFKREQDFYLKKKSAQGSQKSYKRPGSAV
ADSGQPILDEETVSVPSTEENASTPQQVYKYIIQCLVLYNSWPLTESQLMFVQALKDLEK
NDNKAHGEKHEELITLGSPDSHTISEGQKSSGTSKTRKGKEKSSEKEKLAKEKQAPRFEP
QMSIAHSQEDPNKPFWILRLVTEHNEAEFFEVKKDTERADEIRAMKQAWEMTEPGRSIKA
SQARLHYLSRFIKKTPDTEGVLMSESQTKAGEEGIYLGSKAMKESDTKSPLSLDSRETLS
SGSMLWKKWQMSKGLKDLTKSTSSESGGSSPAGKEEREQSTRKENIKTGPRSRSPTILEM
SPQLIRKKLQCVDLSQYIQKTDTDILLQTDELNQQQAMQKAEEVHQFRQYRSRILSIRDI
DQEERLKIKDKVLEMYGEMQDSLDEARQKIFNIREEYRNKLLEAERLRLEDLAAEEAARR
VEPEKKGPAPNSKKKNKGKKQ
Download sequence
Identical sequences ENSSSCP00000004447 ENSSSCP00000004450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]