SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004471 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004471
Domain Number 1 Region: 38-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 162-337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000336
Family Pentraxin (pentaxin) 0.0069
Further Details:      
 
Domain Number 3 Region: 855-1094
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000119
Family Rhodopsin-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004471
Domain Number - Region: 403-462,494-657
Classification Level Classification E-value
Superfamily ARM repeat 0.0187
Family Plakophilin 1 helical region 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004471   Gene: ENSSSCG00000004139   Transcript: ENSSSCT00000004574
Sequence length 1101
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:25290207:25409275:1 gene:ENSSSCG00000004139 transcript:ENSSSCT00000004574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSCHWKWKPSSLLLLFALCIVCIPPSVWGCANCRLVLSNPSGTFTSPCYPNDYPNSQAC
MWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEM
HVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTLDAYQVSVAKSVSIPELRAFTLCF
EANKIGKEDNEWTAFSYSDASFSQLLSFGKTKSGYFLYISGSKCSLNSVLPVKDKDDIFT
ENFEQLCFVWNNSLGSIGVNFKRNYEEVSCDSTVSKVIPGNGKLLLGSNQNEIASLKGDI
YNFRLWNFTMNSKTLSNLSCNVKGNVVDWQNDFWNIPTLALKAESNLSCGSYLIPLPAAE
LASCADLGTLCQATVNPPSTTPPTVSTNMPVTNRTDKQSNDGIVYRISIVVQNTLHHPEV
KVQSMVAEWLNSTFQNWNYTVYVVNISFHQITEEDKIKVRRSLVNDQRLVIWALLVYNAT
NSSSLEGRTIQRKLLRNNESLDEGLRVHTISVRQLGICYAEENPKGYKWPTIQPSIYNAP
CPGKPGFYASRTWFYSYSANTSVAYWGPPDISNCSREANEVANQILNLTSDGQTLNSANI
TSIVEQVKRIVNKEENIDITLGSTLMNIFSNILTSPDSDLLESSSEALKTIDELAFKIDL
SSTSHVNITTRNLALGVSSLSPETNEISNFSIGLPSNNESYFQMDFESGQMDPLASVILP
PNLLENLSEEDSVLVKRAQFTFFNKTGLFQDVETKKGTLVSYVMACSIGNITIRDLKDPV
RIKIKHTTTQAVPHPICAFWDLNKNEGSGFWNTSGCDAHRDSDANQTICLCNHLTHFGVL
MDLQGTASQLDAKNTKVLTFITYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLST
ALLFLNLIFLLDGWITSFHVGGLCTAVAALLHFFLLATFTWMGLEAIHMYIALVKVFNTY
IRRYILKFCIVGWGLPALVVSIVLASRNQNEVYGKESYGKEQGDEFCWIQDPVVFYVSCA
GYFGVMFFLNVAMFIVVMVQICGRNGKRSSRTLREEVLRNLRSVVSLTFLLGMTWGFAFF
AWGPLTVPFTYLFCIFNSLQG
Download sequence
Identical sequences ENSSSCP00000004471 ENSSSCP00000004471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]