SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004541 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004541
Domain Number 1 Region: 572-736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.94e-37
Family Laminin G-like module 0.0000000883
Further Details:      
 
Domain Number 2 Region: 742-923
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-34
Family Laminin G-like module 0.0000000348
Further Details:      
 
Domain Number 3 Region: 139-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-32
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 323-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.95e-28
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 2-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000504
Family Laminin G-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004541   Gene: ENSSSCG00000004207   Transcript: ENSSSCT00000004648
Sequence length 925
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:37207702:37509944:-1 gene:ENSSSCG00000004207 transcript:ENSSSCT00000004648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASMVPS
TYHSASPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNF
REVEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWFPNISTVMFKFRTFSSSALLM
YLATRDLKDFMSVELTDGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISI
VDIDTNQEETIATTSPGNNFGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKD
IEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKN
ESGIILLGSGGTPAPPRRKRRQTGQAYYAIFLNKGRLEVHLSTGARTMRKIVVKPEPSLF
HDGREHSVHVERTRGIFTVQVDEDRRHMQNLTVEQAIEVKKLFIGGAPPEFQPPPLRTIP
SFEGCIWNLVINSVPMDFAQPVSFKNADIGRCAHQKPPEDEDGVVPAETIVQPEPGPTPA
FPVPPTPVLAHGPCAAETEPALLIGSKQFGLSRNSHIAIAFDDTKVKNRLTIEFEVRTEA
ESGLLFYMARINHADFATVQLRNGLPYFSYDLGSGDTNTMIPTKINDGQWHKIKIMRIKQ
EGILDVDGASNRTISPKKADILDVVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNFQMTE
APADLERPTSSYHVGTCFAHAQKGTYFDGTGFAKAVDGFKVGLDLLVEFEFRTTRTTGVL
LGISSQKMDGMGIEMIDEKLMFHVDNGAGWFTAVYDTGIPGHLCDGKWHKVVAKKIKHRV
ELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDGLNQFGLTTNIRFRGCIRFLRLTKGT
GKPLEVNFAKALELRGVQPVSCPAN
Download sequence
Identical sequences A0A287B4F9
ENSSSCP00000004541 ENSSSCP00000004541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]