SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004560 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004560
Domain Number 1 Region: 117-161
Classification Level Classification E-value
Superfamily LysM domain 0.0000000419
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004560   Gene: ENSSSCG00000004222   Transcript: ENSSSCT00000004667
Sequence length 964
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:40815279:40892663:-1 gene:ENSSSCG00000004222 transcript:ENSSSCT00000004667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKESEKELRSFSFFPLIPRLKKKKQAKQNAETASAMATRTHTGKEDANTVILEQDKCNI
AVEEEYITDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYT
AEIQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGAT
VSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVG
GVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDL
PQDLCPLYRPGEWEDLASEKDINPFSKFKSLNKEKRQQDVERAITSDSKSTRPLEKSTEY
TQSRPSDSSGSGKLKKLESSTEATTRSIPVANVLTASSDTRAAFKSIAKENSLLGEDDDF
VDLEELSSQTDSGMDKTDTSKECLSLDPEELRKTKPQKISSTMETQVQSAQNVSGTECDA
ELKGALDLETCEKQDMMPEVDKQSGSPESQVENTLNIHEDLDKVKLIEYYLNKNKEGTQL
SDNSQKDELHDDKNIEPVGIDITLSSSLPQEGDPPIKGTKEPDKTRVKERASLPLQLGSA
TEENMNKDYPDSSLESTLDNSCQGAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPP
MFLCIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYG
KDAKEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEAALPIL
QPHSALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIK
DMDNQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDLSSLELGG
GGGRFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLESVITLQRDSERYMWKADDE
EKEI
Download sequence
Identical sequences ENSSSCP00000023681 ENSSSCP00000004560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]