SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004563 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000004563
Domain Number - Region: 35-64
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0484
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004563   Gene: ENSSSCG00000004225   Transcript: ENSSSCT00000004670
Sequence length 210
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:41422505:41460997:-1 gene:ENSSSCG00000004225 transcript:ENSSSCT00000004670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPILPKGLLETEPLQGRDEDTVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAK
ERHLVEIKQKLGMNLMNELKQNFSRSWHDVQTTTAYKKTQETLSHAGQKATAAFSNVGTA
ISKKFGDMRSHSIGYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNHGGGSF
EEVLSSTAHASAQSSAGGPRRAEEEEELQC
Download sequence
Identical sequences ENSSSCP00000004563 ENSSSCP00000004563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]