SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004604 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000004604
Domain Number - Region: 354-435
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000132
Family Autophagin-like 0.011
Further Details:      
 
Domain Number - Region: 154-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000566
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0191
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004604   Gene: ENSSSCG00000004263   Transcript: ENSSSCT00000004712
Sequence length 578
Comment pep:known chromosome:Sscrofa10.2:1:50213031:50234411:1 gene:ENSSSCG00000004263 transcript:ENSSSCT00000004712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCDICGETVTSEPDMKAHLIVHMEDDVICPFCKLSGVSYDEMCFHIETAHFEQNELER
NIERINSVQYGTSDNRTDSTLQCRMEVNSSIHSACASNHPKILAQSLPKEGSLKHKGFHS
ENVTESRKFLKSKEKQSDLTKIKGSIYETMYSPPECPFCGKIEDCSQDMETHVKTKHTNL
LDTPLEDCDEPLYDCPMCGLICTNYHILQEHVDLHLEESGFGQGMDRVQCSRDLELAQQL
QQEEDRKRRSEESRQEMEEFRKLQRQYGLDNSGGYKQQQLRNMEIEVNRGKMHPSEFHRR
KADMMESLAIGIDDGKTKTSGIMEALYRYYQNAATDVRRVWLSTVVDHFHSSFGDKGWGC
GYRNFQMLLSSLLQNDAYGDCLKDMSVPCIPKIQSMIEDAWKEGFDPQGASQLNNRLQGT
KAWIGACEVYTLLTSLRIKCRIIDFHKSTGPLGTHPRLFEWILNYYSSEREGSPKVVCTS
KPPIYLQHQGHSRTIVGIEERKNRTLCLLIFDPGWPSRDMQKFLKQDMEASSLKQLRKFV
GNLKHKQYQIVAVEGVLSSEEKIARRQASQVFTAEKIP
Download sequence
Identical sequences I3LH67
ENSSSCP00000004604 ENSSSCP00000004604 9823.ENSSSCP00000004604 NP_001229962.1.46622 XP_013840343.1.46622 XP_020952339.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]