SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004611 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004611
Domain Number 1 Region: 90-145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 145-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 42-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000667
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 200-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000746
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004611
Domain Number - Region: 631-891
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00156
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004611   Gene: ENSSSCG00000004270   Transcript: ENSSSCT00000004719
Sequence length 1237
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:55298662:55774196:1 gene:ENSSSCG00000004270 transcript:ENSSSCT00000004719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQWSTCSVTCGQGSQ
VRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRAC
TPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGTQQRSRQCTAAAH
GGSECRGPWAESRECYNPECIANGQWNQWGHWSGCSKSCDGGWERRTRTCQGAAVTGQPC
EGTGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLNATGTASRRCSLS
LHGVAFWEQPSFARCISNEYRHLRHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFY
AGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEDNKEKWEDAQQIYPGSI
ELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWA
RNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNYTVVNSKIIVVTI
RPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCKTVLTDASHTKCL
CDRLSTFAILAQQPREIIMESSSTPSVTLIVGSGLSCLALITLAVVYAALWRYIRSERSI
ILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVLTEAWQSYMAVTG
KIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGGLLYAFVGPAAAV
VLVNMVIGILVFNKLVSRDGILDKKLKHRAGASLWSSCVVLPLLALTWMSAVLAMTDKRS
ILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIM
TDFEKDVDIACRSVLHKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVI
SKVIIQQPTGLHMPMGMNELGNQCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMME
SDYIVMPRSSVNTQPSMKEENKMNIGMETLPHDRLLHYKVNPEFNMNPPVMDQFNMNLEP
HLAPQEHMQNLPFEPRTAVKNFMASELDENAGLSRSETGSTISMSSLERRKSRYSDLDFE
KVMHTRKRHMELFQELNQKFQTLDRFRDIPNTSSLENPAPNKNPWDTFKNPSEYQHYTTI
NVLDTEAKDALELRPAEWEKCLNLPLDLQEGDFQTEV
Download sequence
Identical sequences ENSSSCP00000004611 ENSSSCP00000004611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]