SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004614 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004614
Domain Number 1 Region: 74-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-28
Family Laminin G-like module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004614   Gene: ENSSSCG00000004273   Transcript: ENSSSCT00000004722
Sequence length 1142
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:56203980:56555009:1 gene:ENSSSCG00000004273 transcript:ENSSSCT00000004722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAGSWKLWLWAALLLLPASTSVTVRDKPEKQCPVLRTEEHQFTQDNGDKLEVSGFDLG
ESFSMRRVFCEGDKTCFKLGSSLLIRDTIKVFPKGLPEHFAMVAMFRVRRSTKKERWFLW
QVLNQQNMPQVSIVIDGGKKVVEFMFRAAEGDVLNFIFKNRELRSLFDRQWHKLGIGIQS
QGISLYMDCNLVASQNTDGKGALDFRGRTIIMARASDGKPVDVELHQLKIYCDLNFIAQE
TCCEMSDTKCPEQVGFGSTASLSVPAYASRMSAFLPAKQELTDQCQCIPEKGEAGLQGAP
GSPGQKGDKGQQGENGLHGVPGLPGQKGEQGFEGLKGEIGEKGEQGEKGDPGLAGVNGQD
GSKGDVGPRGPPGPKGEKGDMGPPGPPALTGSLGIQGPQGPPGKEGQRGRRGKTGPPGKP
GPPGPPGPPGIQRVQQTLSEYYHKGNLDEHGAGGPKGEKKGEAGPPGFPGSIGPKGEKGE
SGEPFTKGEKGDRGEPGITGSQGIKGEPGDPGPPGVIGSPGLMGQQGPTGPMGPRGPPGD
VGLPGEHGIPGKPGIKGEKGDPGGIIGPPGLPGPKGEAGPPGKSLPGEPGLDGNPGVPGP
RGPKGERGLPGVQGSPGDIGPPGVGIPGQTGSQGPAGEPGIQGPRGLPGLPGTPGTPGND
GAPGRDGKPGLPGPPGDPIALPLLGDIGALFKNFCGNCQASVPGLKSNKGEEAGAGEPGK
FDSIVHKGDAGPRGPPGIPGREGLKGSKGERGYPGIPGEKGDEGLQGIPGIPGAPGPTGP
PGLLGRTGHPGPTGTKGDKGSEGPPGRPGPPGPPGIPFNEGNGMSSLYKIQGGVNAPSFP
GPPGPPGPKGDPGPMGEPGAMGLPGLEGFPGIKGDRGPAGPPGVAGMLGKPGVPGPPGIP
GEPGERGPVGDVGFPGPEGPSGKPGINGKDGLPGVQGTMGKPGERGPKGERGDQGIPGDR
GPQGERGKPGLPGIKGAIGPVGPPGNKGSPGSPGHQGPPGHPGLPGTPADVVSFEEIKKY
INQEVLRIFEEERMAVFLSQLKLPAAMLAAQAHGRPGPPGKDGLPGPPGDPGPQGYRGQK
GERGEPGIGLPGNPGLPGTSAPGLPGSPGAPGPQGPPGPSGRCNPEDCLYPVSHGHPRTD
GE
Download sequence
Identical sequences ENSSSCP00000004614 9823.ENSSSCP00000004614 ENSSSCP00000004614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]