SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004615 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004615
Domain Number 1 Region: 55-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-34
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004615   Gene: ENSSSCG00000004274   Transcript: ENSSSCT00000004723
Sequence length 922
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:56677556:56773097:-1 gene:ENSSSCG00000004274 transcript:ENSSSCT00000004723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFWKIPVFFFVCSFLGSWGSTTVKRRPRFPVNSNSNGENELCPKVRIGQDDLPGFDLI
SQFQIDKAASRRAIQRVVGSTALQVAYKLGKNVDFRIPTRQLYPSGLPEEYSFLTTFRMT
GSTLEKNWSIWQIQDSSGKEQVGVKINGQTKSVAFSYKGLDGSLQTAAFSNLPSLFDSQW
HKIMIGVERNSATLFVDCNRIESLPIKPRGQIDVDGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPSRETCHELPARITPSQTIDQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPPGEPGKPGVPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGAPGPRGFPGRGIP
GPPGPPGGAGLPGELGRVGPIGDPGRRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRS
GYPGLPGMRGHKGAKGEVGEPGRQGHKGEEGDQGEPGEVGAQGPPGAQGLRGITGIAGAK
GEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEIGPKGDRGAQGSRGIPGLPGPKGDTGLP
GVDGREGIPGMPGTKGEPGKPGPPGEAGLQGLPGIPGIPGAKGVAGEKGNTGAPGKPGQL
GNSGKPGQQGPPGEVGPRGPRGLPGSRGEIGPVGPPGPPGKLGSLGSPGLPGLPGPPGLP
GMKGDRGVVGEPGPKGEQGVSGEEGEAGERGELGDIGLPGPKGSVGNPGEPGLRGPEGSR
GLPGVEGPRGPPGPRGVQGEQGATGLPGIEGPPGRAPTDQHIKQVCMRVMQEHFAAMAAS
LKRPESGASGLPGRPGPPGPPGPPGENGFPGQMGLRGLPGMKGPPGALGLRGPKGDMGER
GDRGPPGRGPKGLPGATGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGPPGF
CEPASCTMQAGQRAFNSKGPDQ
Download sequence
Identical sequences ENSSSCP00000004615 ENSSSCP00000004615 XP_003121321.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]