SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004695 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004695
Domain Number 1 Region: 187-390,621-815
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.06e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00022
Further Details:      
 
Domain Number 2 Region: 36-147
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-18
Family Zf-UBP 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004695   Gene: ENSSSCG00000004351   Transcript: ENSSSCT00000004808
Sequence length 817
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:75068702:75126523:-1 gene:ENSSSCG00000004351 transcript:ENSSSCT00000004808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVKEPSKALTEKAKRSKRPTIPHDEDSSDDIAVGFTCQHVSHAINVNHVKRAITENLWS
VCSECLKERRFSDGQPVLLSDIWLCLKCGFQGCGKNSESQHSVKHFNSWRAELHCIIISL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHVSKTQTNAFSRIIKLCEEKYETGEKNK
GRKSSSVTSVKGITNLGNTCFFNAVMQNLAQSYILTELMNEIKEHGVKLRIVPSLDSQLD
PLVVELSSPGPLTSALFLFLHSMKETEKGPLSPKILFNQLCQKAPGFKSLQQQDSQELLH
YLLDAVRTEETKRIQAGILKAFNNPTTKTADDETRKKVKAYGREGVKMNFIDRIFIGELT
STVMCEECANISTVKDPFIDISLPIIEERVSKPVLLGRTSKYRSLQETDNSQYSGSVTVE
NTQQPKATKKHSPSKDMNQLIHGRKCIRKLSSGDDKAAVMYQKNENLETDGGSSLFASVR
STESTLTESPTDGSEKEASLSDSSVDADSEASESESAPKQTLLLRSGNSYCVHTNGHLRH
PSESEPPARESDSGDDGVAQAVSELRLSSAVAGDGDFDRENPLLNVSNNLCFSENKQMVP
QGPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCEHCTEKKQKYQKETSS
AEKKAEGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTLDLAPFCSA
TCKNVCVGDKVLYGLYGVVEHSGSMRGGHYTAYVKVRTPSRKLLEHITGKKNIPGLKEPD
SESAGQWVHVSDTYVQVVPESRALSAQAYLLFYERIF
Download sequence
Identical sequences F1RXY2
ENSSSCP00000004695 XP_001925615.1.46622 ENSSSCP00000004695 9823.ENSSSCP00000004695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]