SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004772 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004772
Domain Number 1 Region: 22-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 180-224
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004772   Gene: ENSSSCG00000004422   Transcript: ENSSSCT00000004887
Sequence length 326
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:87674779:87686903:1 gene:ENSSSCG00000004422 transcript:ENSSSCT00000004887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEGRPAEVAEVHRRKQFCHWPCQCPRRKPSCPPGVSLVRDGCGCCKICAKQPGDTCNE
ADVCDPHKGLYCDYSADGPWYETGVCAYLVAVGCEFNGVHYQNGQVFQPNPLFSCLCVSG
AIGCTPLFIPKRADNHCSGAKGGKKTHQSKCGRGPSQQQLSTSYRTMPAYRNLPLIWKRK
CLVQATKWTPCSRTCGMGISNRITNENSNCQMRNEKRLCYIQPCDSNISKTIKIPKGKTC
QPTFQLFKAEKFVFSGCSSTQSYRPTFCGICLDKRCCVPNKSKMITIQFDCPNEGSFKWK
MLWITSCVCQRNCRDPGDTFSELKIL
Download sequence
Identical sequences ENSSSCP00000004772 ENSSSCP00000004772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]