SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004801 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004801
Domain Number 1 Region: 118-193,244-395
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-27
Family Eukaryotic proteases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004801   Gene: ENSSSCG00000004452   Transcript: ENSSSCT00000004917
Sequence length 414
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:92967487:92968731:-1 gene:ENSSSCG00000004452 transcript:ENSSSCT00000004917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMLFWWIFFTLGWTLIDGSEMEQDFMWHLRKIPRVVDERTFHLTSPTFEADAKMALNG
VCGIECQKELPSPSLSDLEDSLSYETVFENGTRTLTRVKVQGWVPEPTQNLTNQGVPIRR
KRQVYGTDSRFSILDKRFLTNFPFNTAVKLSTGCSGVLISPNHVLTAAHCVHDGKDYIKG
TRKLRVGLLKMRNKGGGKKRRRGSRRSRREVSGDDGGKESKENLKESAKAGRRRNKSARG
QRTAAGEPSFQWTRVKHTHIPKGWVRGESGDAALDYDYALLELKRSHKKKYMELGISPTI
KKLPSGMIHFSGFDHDRADQLVYRFCSVSDESSDLLYQYCDAESGSTGSGVYLRLKEPGK
KSWKRKIIAVYSGHQWVDVHGVEKDYNVAVRITPLKYAQICLWMHGDDANCTYG
Download sequence
Identical sequences ENSSSCP00000004801 ENSSSCP00000004801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]