SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004838 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004838
Domain Number 1 Region: 138-344
Classification Level Classification E-value
Superfamily vWA-like 5.19e-58
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 361-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-34
Family Laminin G-like module 0.04
Further Details:      
 
Domain Number 3 Region: 47-132
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000562
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 4 Region: 5-44
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000104
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004838   Gene: ENSSSCG00000004484   Transcript: ENSSSCT00000004955
Sequence length 960
Comment pep:known chromosome:Sscrofa10.2:1:101726688:101890065:1 gene:ENSSSCG00000004484 transcript:ENSSSCT00000004955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGLSAPLADQGTTLYLNVTDLKTYQVGWD
TFCVRWSAHRAATSYRLKLSPSDGTRGQEITVRGSETSHCFTGLSPDNDYGVTVFVQTPN
LEGPGVSVKEHTTVKPTEAPTEPPTPPPPPTIPPAREVCKGAKADIVFLTDASWSIGDDN
FNKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIQYRG
GNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALIIQQSGFSVFVV
GVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTS
PGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRLQKNAFVNQPTAELHPNGLPPSYT
IILLFRLLPETPSDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTD
EVKTLFYGSFHKVHIVVTSKSVKIYIDCYEIIEKNIQEAGNITTDGYEILGKLLKGERKS
ATFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGISGAVGPPGPRGDMGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPG
LPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPG
DHGRPGPSGLKGEKGDRGDVASHNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSR
NQPGPPGPPGPPGSVGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGIGSPGPRG
LPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASVPYNGQG
YPEPYVPEGGAYLPEREPFIVPVEPERTAEEYEDYGADEPAHERPPHARWRRALPRGPWQ
Download sequence
Identical sequences ENSSSCP00000004838 ENSSSCP00000004838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]