SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004918 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004918
Domain Number 1 Region: 3992-4359
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.02e-98
Family Regulator of chromosome condensation RCC1 0.0041
Further Details:      
 
Domain Number 2 Region: 368-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-95
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 3 Region: 4487-4835
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-90
Family Hect, E3 ligase catalytic domain 0.0000522
Further Details:      
 
Domain Number 4 Region: 2024-2206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-34
Family SPRY domain 0.01
Further Details:      
 
Domain Number 5 Region: 3419-3520,3575-3806
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.39e-33
Family WD40-repeat 0.009
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004918
Domain Number - Region: 1744-1887,1918-1989
Classification Level Classification E-value
Superfamily ARM repeat 0.000681
Family HspBP1 domain 0.054
Further Details:      
 
Domain Number - Region: 2742-2804
Classification Level Classification E-value
Superfamily UBA-like 0.00936
Family UBA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004918   Gene: ENSSSCG00000004561   Transcript: ENSSSCT00000005038
Sequence length 4859
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:119405161:119560544:1 gene:ENSSSCG00000004561 transcript:ENSSSCT00000005038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTATEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
ILGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVNSMEKSKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPELIDPAGVPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDIPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVYVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWIPENQDSADADPQEHAFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMSSGAGSGARADDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLHQPSTSASEGGGLMTRSESLTAESRLVH
ASPNYRLIKSRSESDLSQPESDEEGYALSGRRNVDLDLASSHRKRGPMHSQLESLSDSWA
RLKHTRDWLCNSSYSFESDFDLTKSLGIHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSISLAGRGSSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHSGAKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQAGVLL
MASFGEGEEDEEEEKKLDSSGETEKRDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQS
KMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVVE
RLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQC
CIVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNH
RTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFE
DVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIRI
LHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKESKEEEKGK
HNRHGLADLSEPQLRTLCIEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKEGS
TSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLTGI
HEDMGKQNTKRHEKKHRHESEEKGDVEQKTESESALDTRTGLTSDDVKSQGTTISKSENE
IASFSLDSAMPAVESQHQITEGKRKNHEHVSKNHDIAQSEIRAVQLSYIYLGAMKSLSAL
LGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIKR
ALGLADLERAQAMIYKLVIHGLLEDQFGGKIKQEIDQQAEESDQAQQAQTPVTTSPSASS
TTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQTP
PISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLEMGF
SLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQSGSTADSRHGAAVVGSG
GKSNDPSYLQSPGDIPSADAAEMEEGFSESPDNLDHTENAASGSGPPARGRSAVTRRHKF
DLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEAM
FGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVSFNQHMKRNHPGC
GRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKSKATSSERYKGQA
PDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLG
ASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAAQ
VLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSAM
ASASERSRGGHSKANKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNLT
TVDDPIQRKFLPGFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYEKSEVEKKG
PLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTPQTLADMGGDLRKCSFI
KLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEESLG
SPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPSTAW
SGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSITCIAWFSEDRPFAVGYF
DGKLLLGTKEPLEKGGIVLIDAHKDTLTSMKWDPTGHILMTCAKEENVKLWGPISGCWRC
LHSLCHPSIVNGIAWCSLPGKGSKLHLLMATGCQSGLVCVWRIPQDTTQTSVTSSEGWWD
QESNCQGAHRKSVGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSVL
QTVVIGSGAIQTTVWIPDVGVAACSNRSKDVLVVNCTAEWAAANHVLATCRTALKQQGVL
GLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCN
PPVPPHHQNCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPESFSVPDLEPVPEDE
LVFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAA
APSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVT
QLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCG
FKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVS
ADGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYT
FGQDRLIGLPEGRARNHNRPQQIPVLAGVVIEDVAVGAEHTLALASTGDVYAWGSNSEGQ
LGLGHTNHVREPTLVTVLQGKNVRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDAV
PPQYGALREVSIHTARARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQ
LRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNA
SDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYNRD
RFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEEVD
LLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKE
YVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEISVEVLKKVV
RYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRPY
DSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTDY
Download sequence
Identical sequences F1S098
ENSSSCP00000004918 ENSSSCP00000004918 XP_020949743.1.46622 9823.ENSSSCP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]