SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004988 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004988
Domain Number 1 Region: 77-122
Classification Level Classification E-value
Superfamily LysM domain 0.000000000942
Family LysM domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004988
Domain Number - Region: 23-33,119-137
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000128
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004988   Gene: ENSSSCG00000004629   Transcript: ENSSSCT00000005112
Sequence length 221
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:133183233:133200016:-1 gene:ENSSSCG00000004629 transcript:ENSSSCT00000005112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPARSLRAGGPRTPRPSAPSPPPPPPPPPRSRSSSEAEEAELSLSLARTKTRSYGS
TASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVSMEQIKRANKLFTNDCIFLKKTLN
IPVISEKPLLFNGLNSIDSPENETVDSGFPHEEELVATGETLSPPSPQESDIQPVQPEEV
TARDFLQRLDLQIKLSTQAAKKLKEESRDEDSPYATSLYHS
Download sequence
Identical sequences F1RYP8
XP_005659663.1.46622 9823.ENSSSCP00000004988 ENSSSCP00000004988 ENSSSCP00000004988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]