SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005017 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005017
Domain Number 1 Region: 1846-1973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 947-1016
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-18
Family TB module/8-cys domain 0.00074
Further Details:      
 
Domain Number 3 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 448-573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 1525-1598
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.63e-17
Family TB module/8-cys domain 0.0000129
Further Details:      
 
Domain Number 6 Region: 2052-2122
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-16
Family TB module/8-cys domain 0.00000725
Further Details:      
 
Domain Number 7 Region: 2130-2259
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 723-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 541-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 10 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.41e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 11 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.41e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 12 Region: 1194-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000131
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 1025-1166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000018
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 15 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000366
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 16 Region: 649-719
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000549
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2217-2333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000113
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 18 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000147
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 19 Region: 1765-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 20 Region: 2008-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000503
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 21 Region: 1966-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000898
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 22 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 23 Region: 1153-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.008
Further Details:      
 
Domain Number 24 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000312
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 25 Region: 1444-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000373
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 26 Region: 1808-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000264
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 27 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000254
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005017   Gene: ENSSSCG00000004658   Transcript: ENSSSCT00000005143
Sequence length 2336
Comment pep:novel chromosome:Sscrofa10.2:1:137103320:137303566:1 gene:ENSSSCG00000004658 transcript:ENSSSCT00000005143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGRLLEVALGFTVLLASYTSHGADANLEAGNGKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQECY
ILCLNLGSCNDKHCINYFGYFSCHCGQPVQEKKCVNRSVCLSRNRCTGTQGVPGPQVQRD
YRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCC
DVGRCWSPGVTVTPEMCPIRATEDFNKLCSVPMVVPERPGYPSPPLGPIPPVHPVPPGFP
PGPQIPVPRPPVEYPYPSREPPRVLPVNVTDYCQLFRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETSGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGMTSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP
TKTICIETIKGTCWQTIIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPNGMTLDATGRICLDIRLETCFL
RYEDEECTLPVVGRHRMDACCCSVGAAWGTEECEECPPRNTPEYEELCPRGPGFATKEIT
NGKPFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCEC
PSGHQLSPNISACIDINECELSAHLCPHGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSPD
RKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDVRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCEQCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC
SHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGF
ILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLE
PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDAEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYIL
EGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF
RCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGMYICICGPG
YQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPTQDECLDNR
Download sequence
Identical sequences ENSSSCP00000005017 ENSSSCP00000005017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]