SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005042 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005042
Domain Number 1 Region: 322-498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-62
Family SPRY domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-17
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005042
Domain Number - Region: 111-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000168
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number - Region: 248-288
Classification Level Classification E-value
Superfamily YppE-like 0.0419
Family YppE-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005042   Gene: ENSSSCG00000004681   Transcript: ENSSSCT00000005168
Sequence length 500
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:141375239:141392107:-1 gene:ENSSSCG00000004681 transcript:ENSSSCT00000005168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKVSSNPSCNTDSDNYIEVNDLITQIPSKVQIQDITMELHCPLCNDWFRDPLMLTCGHNF
CQSCIENFWKQEAKETFCPECKMLCQYSNCTFNLVLEKLIEKIKKLPLLKGHPQCQEHGE
NLKLFSKPDGKLICFQCKDARLSVGQSKEFLQIADAVRFFTEELIIHQGQLEATLKELQS
LRNMQKDAIAAYKENKLHLQQHISLEFLKLHQFLHSKEKDILNELREEGKALNEEMELNL
SHIQEQCLLAKEMLVSIQARMEQQNSFDFLKDITPLLDSLDQGMRVLTPRELISRKLNLG
LFKGPIQYMMWREMQSTLSPGLSPLTLDPKTAHPNLVLSKNRTSVWHGDIKQVMPDDPER
FDSSVAVLGSKGFTSGKWYWEVEVAKKTKWTVGVVRESILRKGSCPLTPEQGFWLLRLRN
QTDLKALDLPSCSLKLNNNLNKVGIYLDYEGGQVSFYNAKTMNHIYTFSSTFMEKLYPYF
CPCLNDGGENKEPLHIVHPQ
Download sequence
Identical sequences 9823.ENSSSCP00000005042 ENSSSCP00000005042 ENSSSCP00000005042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]