SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005078 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005078
Domain Number 1 Region: 151-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-118
Family Transglutaminase core 0.0000000159
Further Details:      
 
Domain Number 2 Region: 9-149
Classification Level Classification E-value
Superfamily E set domains 4.2e-45
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 611-708
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.28e-26
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 
Domain Number 4 Region: 489-609
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.41e-25
Family Transglutaminase, two C-terminal domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005078   Gene: ENSSSCG00000004712   Transcript: ENSSSCT00000005204
Sequence length 709
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:143025884:143041134:1 gene:ENSSSCG00000004712 transcript:ENSSSCT00000005204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAPLPVVALKLRSVDLQSPRNNKEHRTQEISLQRLIVRRGQAFTMQLQFNRPFHSGTDH
LTFVAETGPAPTEHLGTRATFLLTDTRQGNVWSASDFTINANSLFVSLFTPANAVIGPYS
LKIQISQDQGHSTTHSLGTFILLFNPWSAEDDVYLPSEILLQEYIMMDYGFVYKGHERFV
TPWPWNYGQFEEDIIDICFEILNKSLYFLENPAKDCSQRNDVVYVCRVVTAMINSNDDSG
VLQGNWGEDYSQGVSPLEWNGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPT
RVVSNFRSAHNADANLTIDTYYDQNAEMLPPQKRDKIWNFHVWNECWMIRKDLPPEYNGW
QVLDPTPQQTSSGLFRCGPASVKAVREGEVHLPFDTAFVYAEVNADEVVWLLEDGRAQEI
LAHKTSSIGKEISTKMVGSDQRQNITSSYKYPEGSPEERSVFMKASQKMLGPRGTLSPFL
DLLGSGGFENQPVQLQLHLTRTPQWGQDLLLKLHARRVTDRAHPQGPIQLVVRFCAQTLL
HNGGTREPLWRQTSHLTLDFGEVIEWPLLLPYNNYRNKLTDEKMIRVSGIAKVEGTGRSM
LVLKDISLEPPDLSIEVSEKAEVGKALKVHISLTNTLSVPLTHCTMVLEGSGLINGQISK
DLGTLVAGRTIQIQMDLYPIKAGPRQLQVLISSKEIKEIKGYKDILVAA
Download sequence
Identical sequences ENSSSCP00000005078 ENSSSCP00000005078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]