SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005079 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005079
Domain Number 1 Region: 150-466
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.01e-126
Family Transglutaminase core 0.0000000103
Further Details:      
 
Domain Number 2 Region: 5-149
Classification Level Classification E-value
Superfamily E set domains 3.39e-42
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 620-718
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.23e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 507-618
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-24
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005079   Gene: ENSSSCG00000004713   Transcript: ENSSSCT00000005205
Sequence length 721
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:143053337:143073905:1 gene:ENSSSCG00000004713 transcript:ENSSSCT00000005205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGHAVAGLEVALIDLQSSWNNVRHHTEEISSDRLLVRRGQAFIITLYFRNRAFQPGLDNI
IFVADTGPLPDVAKGTRAVFSLAGHGGPSPWMASLEATGAASMEVSLCAPPMAAVGRYLL
KVHIESLQGPVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIR
PCPWNYGQFEENIIDICLELLAKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDNGV
LNGNWSENYLDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTR
VITNFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARRDLPEGYGGWQ
VLDATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMSWLVFRGKEQKLH
QDTSSVGNFISTKGIQSNERDDITENYKYGEGSPQERQVFLKALQKLKAGGSQGSLREDL
QPSGSLPPRDSPRSLATPSLRPSDVVQVSLKFQLLDPPDMGRDIRFVLLALNMSLQFKDL
RVNLSAQSLLHDGSPLPPFWQDTAFLTLAPEEAKTHSCKIPYSQYSQYLSTDKLIRISAL
GEEKNSPEKILVNKIITLAYPSIMINVLGAAIVNQPLSIQVIFSNPLSEPVADCVLTVEG
SGLFRKQQRVLIGVLKPQHRASLTLETVPFKSGQRQIQANLRSDKFKDIKGYKNIYVDLG
L
Download sequence
Identical sequences ENSSSCP00000005079 9823.ENSSSCP00000005079 ENSSSCP00000005079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]