SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005080 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005080
Domain Number 1 Region: 144-452
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.06e-76
Family Transglutaminase core 0.00000127
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 5.25e-41
Family Transglutaminase N-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-28
Family Transglutaminase, two C-terminal domains 0.00062
Further Details:      
 
Domain Number 4 Region: 472-582
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.79e-24
Family Transglutaminase, two C-terminal domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005080   Gene: ENSSSCG00000004714   Transcript: ENSSSCT00000005206
Sequence length 688
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:143112249:143129438:1 gene:ENSSSCG00000004714 transcript:ENSSSCT00000005206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STTGLGIKCCDFQAARNNAEHHTQDISSQRLTVRRGQPFTISLHFQAPVHTFLSTMKKIV
LVAQTGEQPSQDNRTQATFSISSLGDAKSWSARVKERDDQSWTISVTTPADAVIGHYSLL
LQASGREQCLGQFTLLFNPWSQEDAVFLGNKAQCSEYVLNQNGLIFTGTADCIEAMPWDF
GQFEEDVIDLSLKLLSVNKQVEEWGDPVHVAHTLGTLLQVLKEKSVLPTSQIQTAQEKAL
LYKRRGSAPILRQWLTGLGRPVYESQAWVLAAVTCTVLRGLGIPARVVTTFTSAQGTGGS
LLVDEFYSKEGLQNGEGQRGRIWIFQTSTECWMKRPALPQGYDGWQILHPSAPSGVRVLG
ECDLVPVRAVKEGTVGLTPAVLDIFASVNASCVVWKCREDGTLELTESNTKYCGNNISTK
VVASDRCEDITQNYKYPEGSPKEKKVLEKVWKNRRKHGKVRDVYPPSLETGDPLHFFLEA
PSSLPLGGDARISVNLINPNDYEKEVKLALGLQAVYYNGVLAATLWKDQFLLTVEANSAK
KRHSFLSFSNFEQNPPENTLLRLTAMATHSTLTCFDQKDIAICRPQLAIEMPETAVQHQP
LTASVSIHNTLDAPLNDCVISIFGRGLIYREKSYRLSSVQPGRTVCTKLQFTPMHVGLQR
LTVEMDCNMFQNLTNFRSITVVAPEPPA
Download sequence
Identical sequences ENSSSCP00000005080 ENSSSCP00000005080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]