SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005098 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005098
Domain Number 1 Region: 9-357
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.42e-133
Family Calpain large subunit, catalytic domain (domain II) 0.00000000512
Further Details:      
 
Domain Number 2 Region: 361-512
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.62e-57
Family Calpain large subunit, middle domain (domain III) 0.00000166
Further Details:      
 
Domain Number 3 Region: 532-707
Classification Level Classification E-value
Superfamily EF-hand 1.23e-51
Family Penta-EF-hand proteins 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005098   Gene: ENSSSCG00000004728   Transcript: ENSSSCT00000005224
Sequence length 709
Comment pep:known chromosome:Sscrofa10.2:1:143852200:143889556:-1 gene:ENSSSCG00000004728 transcript:ENSSSCT00000005224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLLPGFFCDRVIRERDRRNGEGTATQPLKYEGQDFVVLRQRCLAQKCLFEDRVFPAGV
QSLGSLELSQKTKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTL
NKRLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEF
WSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEIKDAPRDMYKIMKKAIERGS
LMGCSIDTIVPVQFETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPWGQVEWNGS
WSDSWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTADALESDKLQT
WTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKN
RRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYINMREVSERFR
LPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVPEPSNTDQESEEQQ
QFRNIFRQIAGDDMEICADELKNVLNRVVNKHKDLKTEGFTLESCRSMIALMDTDGSGRL
NLQEFHHLWKKIKSWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYAD
KYMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences F1SI20
ENSSSCP00000005098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]