SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005119 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005119
Domain Number 1 Region: 347-475
Classification Level Classification E-value
Superfamily Plus3-like 4.97e-46
Family Plus3 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005119   Gene: ENSSSCG00000004747   Transcript: ENSSSCT00000005246
Sequence length 701
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:144958165:145010460:-1 gene:ENSSSCG00000004747 transcript:ENSSSCT00000005246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAAAAAAAVAVPLAGGQEGSPGGVRRGSRGTTMVKKRKGRVVIDSDTEDSGSDENLD
QQCSSGTRKYKEGSPPYCEETISWESFVLGQRYQWTFGSNKNKKKGKARKIEKKGTMKKQ
ANKTASSGSSDKDTSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGD
EEDRARLEQMTEKEREQELFNRIEKREVLKKRFEIRKKLKTAKKKEKKEKKKKQEEEQEK
KKLTQIQESQVSFHNKPSPEKKKRKNKKKFQAQGELKIKRQKKKKKKTELLAKKQPLKTS
EVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKL
ERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLR
HGSDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFND
QDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEERAEAL
DRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQCKPTIVSNSRD
PAVQAAILAQLNAKYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFKVHDFDVKID
LQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences ENSSSCP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]