SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005134 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005134
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.06e-21
Family Chaperone J-domain 0.0005
Further Details:      
 
Domain Number 2 Region: 189-263
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000462
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005134   Gene: ENSSSCG00000004762   Transcript: ENSSSCT00000005261
Sequence length 304
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:145675040:145717529:1 gene:ENSSSCG00000004762 transcript:ENSSSCT00000005261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTKELLQMDLYALLGIGEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL
EVLTDAAARAAYDKVRKAKKQAAERTQKLDERRKKVKLDLEARELQAQTHGSEEEEESRS
ARTLEQEIERLREEGSRQLEEQQRLIQEQIRQEREQRLRGMTENLESKGTPKLKLKWKST
KESESQGGYSKDVLLRLLQKYGEVLNLVLSSKKAGTAVVEFATVRAAELAVQNEVGLVDN
PLKISWLEGRPQSSMGPSHPGASQGSVLSERDYESLVMMRMRQAAERQQLIAQMQQEEQA
GQPT
Download sequence
Identical sequences ENSSSCP00000005134 ENSSSCP00000005134 9823.ENSSSCP00000005134 XP_001929418.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]