SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005194 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005194
Domain Number 1 Region: 7-253
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-94
Family ALDH-like 0.00000000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005194   Gene: ENSSSCG00000004822   Transcript: ENSSSCT00000005324
Sequence length 259
Comment pep:known chromosome:Sscrofa10.2:1:155732315:155751077:-1 gene:ENSSSCG00000004822 transcript:ENSSSCT00000005324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLAFLLQVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQC
CTAASRVFVEEQVYSEFVKRSVEYAKKRPVGDPFDVRTEQGPQIDQKQFNKILDLIESGK
KEGAKLECGGSAMEDRGLFIKPTVFSEVTDTMRIAKEEIFGPVQPILKFKNIEEVIKRAN
SLEYGLTAAVFTKNLDKALKLASALESGTVWINCYNAIYAQAPFGGFKMSGNGRELGEYA
LAEYTEVKTVTIKLDDKNP
Download sequence
Identical sequences ENSSSCP00000005194 ENSSSCP00000005194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]