SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005216 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005216
Domain Number 1 Region: 43-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 5.64e-36
Family Methylmalonyl-CoA epimerase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005216   Gene: ENSSSCG00000004846   Transcript: ENSSSCT00000005348
Sequence length 176
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:159938592:159968311:1 gene:ENSSSCG00000004846 transcript:ENSSSCT00000005348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLLRVTGASAAGFFSRLQTPVPTVRTFSMSLTSNQVASPVWNLGRLNHIAIAVQDLEK
SKAFYKNVLGAQVGEMASIPEHGVSVVFVNLGNTKMELLHPLGNDSPIAGFLQKNKAGGM
HHICMEVDNINAAMMDLKEKKIRILSEEPKIGAHGKPVIFLHPNDCGGVLVELEQA
Download sequence
Identical sequences 9823.ENSSSCP00000005217 ENSSSCP00000005216 ENSSSCP00000005216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]