SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005280 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005280
Domain Number 1 Region: 51-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-74
Family Lectin leg-like 0.00000000494
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005280
Domain Number - Region: 287-323
Classification Level Classification E-value
Superfamily HMG-box 0.00256
Family HMG-box 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005280   Gene: ENSSSCG00000004908   Transcript: ENSSSCT00000005415
Sequence length 517
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:179185031:179206074:1 gene:ENSSSCG00000004908 transcript:ENSSSCT00000005415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSRQRGLQTGARPLFCALLLSLFRFVGGDGVGGDPAAAGSTGSSAAQPHRRFEYKYSF
KGPHLVQSDGTVPFWAYAGNAIPSSDQIRIAPSLKSQRGSVWTKAKAAFENWEVEVTFRV
TGRGRIGADGLAIWYTENQGLEGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVIIGNNG
QIQYDHQNDGANQALASCQRDFRNKPYPIRAKIIYYQKTLTVMIHNGFTPDKNDYEFCAK
VENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEE
FEHFQQELDKKKEEFQKDHPDLQGHPADEIFESIGDRELRQIFEGQNRIHLEIKQLNRQL
DMILDEQRRYVSSLTEEISKRGAGIPGQHGQITQQELDTVVNTQHEILRQVNEMKNSMSE
TVRLVSGIQHPGSAGGVYETTQHFNDIKEHLHIVKRDIDHLVQRNMPSNEKPKCPELPPF
PCLSTVHFVIFVVVQTMLFIGYVMYRSQQEAAAKKFF
Download sequence
Identical sequences 9823.ENSSSCP00000005280 ENSSSCP00000005280 ENSSSCP00000005280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]