SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005355 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005355
Domain Number 1 Region: 411-468
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000124
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 293-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 472-523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 353-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000889
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 182-232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000111
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005355   Gene: ENSSSCG00000004980   Transcript: ENSSSCT00000005492
Sequence length 576
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:187774212:188055229:1 gene:ENSSSCG00000004980 transcript:ENSSSCT00000005492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEISSTAGESFLAEGPT
NEILDVYMIHQQPNPGVHYEYVIMGNNAISPQVPPHRRPGEPFNGQLGPEGRSQEEGEEK
EGDEPKADTHGGAPEIFTSESAQTFPVRHPDRFSSHRPDNVVPPAPQPPRRSRDHNWKQL
GTTECSTTCGKGSQYPIFRCVHRSTHEEVPESYCDSSMKPTPEEEPCNIFPCPAFWDIGE
WSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTD
WTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSE
RCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQC
SVECGSGTQQREVICVRKNADTFEVLDPYECSFLERPPSQQSCHLKPCGAKWFNTEWSMC
SKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEEKESCNPQDCVPEVAPDENCKDRYYNC
NVVVQARLCVYNYYKTACCVSCTRVASRHSGFLGSR
Download sequence
Identical sequences ENSSSCP00000005355 ENSSSCP00000005355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]